PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 400aa    MW: 43131.2 Da    PI: 5.9103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615291.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-1756101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l ++v ++G ++W++Iar ++ gR++k+c++rw + 
   XP_009615291.1  56 KGPWSQEEDAVLSELVSKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 101
                      79******************************.***********985 PP

2Myb_DNA-binding57.62.9e-18108152147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eEd +++ a++ +G++ W++Ia+ ++ gRt++ +k++w++ 
   XP_009615291.1 108 RKPFTEEEDNIIISAHAVHGNR-WASIAKLLP-GRTDNAIKNHWNST 152
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.87951102IPR017930Myb domain
SuperFamilySSF466892.7E-3153149IPR009057Homeodomain-like
SMARTSM007174.1E-1555104IPR001005SANT/Myb domain
PfamPF002491.4E-1656101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2657109IPR009057Homeodomain-like
CDDcd001672.37E-1458100No hitNo description
PROSITE profilePS5129426.804103157IPR017930Myb domain
SMARTSM007171.0E-17107155IPR001005SANT/Myb domain
PfamPF002491.7E-16108152IPR001005SANT/Myb domain
CDDcd001678.54E-14110153No hitNo description
Gene3DG3DSA:1.10.10.609.8E-25110156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MEEEAEQSNF KLRDAAVNDG ESSAVSFKAV DDTDAMFPDG GGDGNSGGGG GGGKVKGPWS  60
QEEDAVLSEL VSKFGARNWS LIARGIPGRS GKSCRLRWCN QLDPAVKRKP FTEEEDNIII  120
SAHAVHGNRW ASIAKLLPGR TDNAIKNHWN STLRRRFAGL RKVKPVHCER LDNSSIDRVK  180
VSSEETKSFE DHNQPKAQEA GEVILMQCEP SQFEDRSPTN EMSAAPEKNT HLVSGRCHST  240
IMEKNPSVSR PIAKIGAFDV FNLSSAAFAS SRTVPMQGPL LQASSPSFGI CKLLEGVSDD  300
PVIPLRCGHG CCSAPSMSFS GSSLLGPEFV EYEELPAVCS NELTAIATDL NNIAWIKSGL  360
DNAGRLSGRT TSQRDYRGSS TSTPLPMSNF TLPTEVESLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-43551566107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-40HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615291.10.0PREDICTED: transcription factor MYB122-like
TrEMBLM1CLE11e-142M1CLE1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000699211e-141(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-102myb domain protein 109